PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103815.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 276aa    MW: 32264.5 Da    PI: 6.8852
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103815.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK758.9e-24151200352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     k++s e+++ yF++pi++AAkeL+v+lT+LK++ R++GI+RWPhRk+ s+
  XP_009103815.1 151 KSLSREEIKPYFYMPITKAAKELNVGLTLLKKKSRELGISRWPHRKLMSI 200
                     789********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.142135220IPR003035RWP-RK domain
PfamPF020425.1E-20153200IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTDHKQLRNW SQFDDYEFIQ EENLFSLFDH SLSFDYNSST NNPLSDIQTQ TWFSFQDIIN  60
VDPISTCFLA GDHTFMASDD VQAISTFSQD VFSGSWNEIT GNFNNHFEPI RNEMSSIGAP  120
NMEMILHESN NTMKEITCYK RRERTDGVLV KSLSREEIKP YFYMPITKAA KELNVGLTLL  180
KKKSRELGIS RWPHRKLMSI QGIITNLLDH LGKTEDERIR SKLTKALKIL EREKKMIEED  240
PNLEFGDETK RLRQACFKAN YKRRRILSIS NTSFFS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261265KRRRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103815.10.0PREDICTED: protein RKD3-like
SwissprotQ9FGD15e-96RKD3_ARATH; Protein RKD3
TrEMBLA0A0D3D8A10.0A0A0D3D8A1_BRAOL; Uncharacterized protein
STRINGBra012122.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121801932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.13e-97RWP-RK domain-containing protein